GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Wax Melt Hearts Box
1 product(s) found for "Wax Melt Hearts Box"
Lime basil and mandarin Hearts
Wax Melt Hearts Box
Lime basil and mandarin Hearts
Lime Basil and Mandarin. Wax melt hearts Box of 9. Similar in style to the Jo Malone scent, Lime basil and Mandarin fragrance oils have notes of peppery basil and aromatic white Thyme which brings an unexpected...
£4.50
Units in Stock: 4
£4.50
Details
Add To Cart
Lime Basil and Mandarin. Wax melt hearts Box of 9. Similar in style to the Jo Malone scent, Lime basil and Mandarin fragrance oils have notes of peppery basil and aromatic white Thyme which brings an unexpected...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Hosted online store
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
10+ years
650k stores created
No card required
Easy to create
What's the catch?
No catch
0% commission
Free forever!
Feature upgrades available
Get Started
i